Lineage for d3gp9c1 (3gp9 C:2-131)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194613Protein automated matches [190032] (18 species)
    not a true protein
  7. 2194614Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2194627Domain d3gp9c1: 3gp9 C:2-131 [176806]
    Other proteins in same PDB: d3gp9a2, d3gp9b2, d3gp9c2, d3gp9d2, d3gp9e2, d3gp9f2
    automated match to d2b8pa1
    complexed with gdp, mg, po4

Details for d3gp9c1

PDB Entry: 3gp9 (more details), 1.8 Å

PDB Description: Crystal structure of the Mimivirus NDK complexed with GDP
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gp9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gp9c1 d.58.6.1 (C:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpet

SCOPe Domain Coordinates for d3gp9c1:

Click to download the PDB-style file with coordinates for d3gp9c1.
(The format of our PDB-style files is described here.)

Timeline for d3gp9c1: