Lineage for d3gp9c_ (3gp9 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1907824Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1908074Protein automated matches [190032] (15 species)
    not a true protein
  7. 1908075Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 1908088Domain d3gp9c_: 3gp9 C: [176806]
    automated match to d2b8pa1
    complexed with gdp, mg, po4

Details for d3gp9c_

PDB Entry: 3gp9 (more details), 1.8 Å

PDB Description: Crystal structure of the Mimivirus NDK complexed with GDP
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gp9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gp9c_ d.58.6.1 (C:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfpet

SCOPe Domain Coordinates for d3gp9c_:

Click to download the PDB-style file with coordinates for d3gp9c_.
(The format of our PDB-style files is described here.)

Timeline for d3gp9c_: