SCOPe 2.05: Domain d3gp9b_: 3gp9 B:

Lineage for d3gp9b_ (3gp9 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3gp9b_: 3gp9 B: [176805]
   automated match to d2b8pa1
   complexed with gdp, mg, po4

Details for d3gp9b_

PDB Entry: 3gp9, 1.8 Å

PDB Description: Crystal structure of the Mimivirus NDK complexed with GDP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gp9b_:

Sequence; same for both SEQRES and ATOM records:

>d3gp9b_ d.58.6.1 (B:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
dncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsa
vdeisiwfpe

Timeline for d3gp9b_:

• d3gp9b_ first appeared in SCOPe 2.01
  
• d3gp9b_ appears in SCOPe 2.04
  
• d3gp9b_ is called d3gp9b1 in SCOPe 2.06
  
• d3gp9b_ appears in the current release, SCOPe 2.08, called d3gp9b1