Lineage for d3gp9a_ (3gp9 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) 
Protein automated matches [190032] (15 species)
not a true protein
Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) 
Domain d3gp9a_: 3gp9 A: [176804]
automated match to d2b8pa1
complexed with gdp, mg, po4
Details for d3gp9a_
PDB Entry: 3gp9 (more details), 1.8 Å
PDB Description: Crystal structure of the Mimivirus NDK complexed with GDP
PDB Compounds: (A:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d3gp9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gp9a_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
aglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsy
fndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsed
savdeisiwfpet
SCOPe Domain Coordinates for d3gp9a_:
Click to download the PDB-style file with coordinates for d3gp9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gp9a_:
- d3gp9a_ first appeared in SCOPe 2.01
- d3gp9a_ appears in SCOPe 2.04
- d3gp9a_ is called d3gp9a1 in SCOPe 2.06
- d3gp9a_ appears in the current release, SCOPe 2.08, called d3gp9a1
View in 3D
