![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
![]() | Protein automated matches [190196] (7 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:28450] [188843] (3 PDB entries) |
![]() | Domain d3gp5b_: 3gp5 B: [176802] automated match to d1e59a_ complexed with 3pg, pg4, pg6, vo4 |
PDB Entry: 3gp5 (more details), 2.25 Å
SCOPe Domain Sequences for d3gp5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gp5b_ c.60.1.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]} myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylg
Timeline for d3gp5b_: