Lineage for d3gp3c_ (3gp3 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998539Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 998540Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 998541Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 998593Protein automated matches [190196] (7 species)
    not a true protein
  7. 998594Species Burkholderia pseudomallei [TaxId:28450] [188843] (3 PDB entries)
  8. 998597Domain d3gp3c_: 3gp3 C: [176799]
    automated match to d1e59a_
    complexed with pg4, po3, sep

Details for d3gp3c_

PDB Entry: 3gp3 (more details), 1.5 Å

PDB Description: crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine
PDB Compounds: (C:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3gp3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gp3c_ c.60.1.1 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgd

SCOPe Domain Coordinates for d3gp3c_:

Click to download the PDB-style file with coordinates for d3gp3c_.
(The format of our PDB-style files is described here.)

Timeline for d3gp3c_: