SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3gnxa_ (3gnx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088890Family c.1.15.3: Xylose isomerase [51665] (2 protein domains)
  6. 2089092Protein automated matches [190298] (1 species)
    not a true protein
  7. 2089093Species Streptomyces rubiginosus [TaxId:1929] [187248] (15 PDB entries)
  8. 2089104Domain d3gnxa_: 3gnx A: [176787]
    automated match to d1clka_
    complexed with mn, xyl

Details for d3gnxa_

PDB Entry: 3gnx (more details), 2 Å

PDB Description: Structure of dehydrated D-xylose isomerase from streptomyces rubiginosus
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d3gnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gnxa_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
yqptpedrftfglwtvgwqgrdpfgdatrraldpvesvqrlaelgahgvtfhdddlipfg
ssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktirn
idlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaiep
kpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagklf
hidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwas
aagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefdv
daaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d3gnxa_:

Click to download the PDB-style file with coordinates for d3gnxa_.
(The format of our PDB-style files is described here.)

Timeline for d3gnxa_: