Lineage for d3gnsa1 (3gns A:1-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842402Species Staphylococcus aureus [TaxId:1280] [189086] (3 PDB entries)
  8. 2842407Domain d3gnsa1: 3gns A:1-256 [176781]
    Other proteins in same PDB: d3gnsa2
    automated match to d1ulua_
    complexed with na

Details for d3gnsa1

PDB Entry: 3gns (more details), 2.71 Å

PDB Description: Crystal Structure of the Staphylococcus aureus Enoyl-Acyl Carrier Protein Reductase (FabI) in apo form (one molecule in AU)
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d3gnsa1:

Sequence, based on SEQRES records: (download)

>d3gnsa1 c.2.1.2 (A:1-256) Enoyl-ACP reductase {Staphylococcus aureus [TaxId: 1280]}
mlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpea
hlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdi
ssysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgp
dnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsdlssg
vtgenihvdsgfhaik

Sequence, based on observed residues (ATOM records): (download)

>d3gnsa1 c.2.1.2 (A:1-256) Enoyl-ACP reductase {Staphylococcus aureus [TaxId: 1280]}
mlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpea
hlyqidvqsdeevingfeqigkdvgnidgvyhsiqdissysltivaheakklmpeggsiv
attylynvmgvakasleanvkylaldlgpdnirvnaisagpirtlntilkeieeraplkr
nvdqvevgktaayllsdlssgvtgenihvdsgfhaik

SCOPe Domain Coordinates for d3gnsa1:

Click to download the PDB-style file with coordinates for d3gnsa1.
(The format of our PDB-style files is described here.)

Timeline for d3gnsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gnsa2