SCOP 1.69: Domain d1guld1: 1gul D:81-220

Lineage for d1guld1 (1gul D:81-220)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries)

8. Domain d1guld1: 1gul D:81-220 [17678]
   Other proteins in same PDB: d1gula2, d1gulb2, d1gulc2, d1guld2, d1gule2, d1gulf2, d1gulg2, d1gulh2

Details for d1guld1

PDB Entry: 1gul, 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1guld1:

Sequence; same for both SEQRES and ATOM records:

>d1guld1 a.45.1.1 (D:81-220) Class alpha GST {Human (Homo sapiens), (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

Timeline for d1guld1:

• d1guld1 first appeared (with stable ids) in SCOP 1.55
  
• d1guld1 appears in SCOP 1.67
  
• d1guld1 appears in SCOP 1.71
  
• d1guld1 appears in the current release, SCOPe 2.08