Lineage for d1guld1 (1gul D:81-220)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3713Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 3725Domain d1guld1: 1gul D:81-220 [17678]
    Other proteins in same PDB: d1gula2, d1gulb2, d1gulc2, d1guld2, d1gule2, d1gulf2, d1gulg2, d1gulh2

Details for d1guld1

PDB Entry: 1gul (more details), 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1guld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guld1 a.45.1.1 (D:81-220) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOP Domain Coordinates for d1guld1:

Click to download the PDB-style file with coordinates for d1guld1.
(The format of our PDB-style files is described here.)

Timeline for d1guld1: