SCOPe 2.01: Domain d3gnjc_: 3gnj C:

Lineage for d3gnjc_ (3gnj C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Desulfitobacterium hafniense [TaxId:272564] [188874] (1 PDB entry)

8. Domain d3gnjc_: 3gnj C: [176779]
   automated match to d1fb0a_

Details for d3gnjc_

PDB Entry: 3gnj, 1.99 Å

PDB Description: The crystal structure of a thioredoxin-related protein from Desulfitobacterium hafniense DCB

PDB Compounds: (C:) Thioredoxin domain protein

SCOPe Domain Sequences for d3gnjc_:

Sequence; same for both SEQRES and ATOM records:

>d3gnjc_ c.47.1.0 (C:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
snamslekldtntfeqliydegkaclvmfsrknchvcqkvtpvleelrlnyeesfgfyyv
dveeektlfqrfslkgvpqilyfkdgeykgkmagdveddeveqmiadvled

Timeline for d3gnjc_:

• d3gnjc_ is new in SCOPe 2.01-stable
  
• d3gnjc_ appears in SCOPe 2.02
  
• d3gnjc_ appears in the current release, SCOPe 2.08, called d3gnjc1