SCOPe 2.08: Domain d3gnjb1: 3gnj B:1-107

Lineage for d3gnjb1 (3gnj B:1-107)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Desulfitobacterium hafniense [TaxId:272564] [188874] (1 PDB entry)

8. Domain d3gnjb1: 3gnj B:1-107 [176778]
   Other proteins in same PDB: d3gnja2, d3gnjb2, d3gnjc2, d3gnjd2
   automated match to d1fb0a_

Details for d3gnjb1

PDB Entry: 3gnj, 1.99 Å

PDB Description: The crystal structure of a thioredoxin-related protein from Desulfitobacterium hafniense DCB

PDB Compounds: (B:) Thioredoxin domain protein

SCOPe Domain Sequences for d3gnjb1:

Sequence; same for both SEQRES and ATOM records:

>d3gnjb1 c.47.1.0 (B:1-107) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mslekldtntfeqliydegkaclvmfsrknchvcqkvtpvleelrlnyeesfgfyyvdve
eektlfqrfslkgvpqilyfkdgeykgkmagdveddeveqmiadvle

Timeline for d3gnjb1:

• d3gnjb1 first appeared in SCOPe 2.01, called d3gnjb_
  
• d3gnjb1 appears in SCOPe 2.07