| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Desulfitobacterium hafniense [TaxId:272564] [188874] (1 PDB entry) |
| Domain d3gnja1: 3gnj A:1-108 [176777] Other proteins in same PDB: d3gnja2, d3gnjb2, d3gnjc2, d3gnjd2 automated match to d1fb0a_ |
PDB Entry: 3gnj (more details), 1.99 Å
SCOPe Domain Sequences for d3gnja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gnja1 c.47.1.0 (A:1-108) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mslekldtntfeqliydegkaclvmfsrknchvcqkvtpvleelrlnyeesfgfyyvdve
eektlfqrfslkgvpqilyfkdgeykgkmagdveddeveqmiadvled
Timeline for d3gnja1: