![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.15: Mo25 protein [101407] (2 proteins) automatically mapped to Pfam PF08569 this is a repeat family; one repeat unit is 1upl A:195-240 found in domain |
![]() | Protein automated matches [191051] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries) |
![]() | Domain d3gnia_: 3gni A: [176776] automated match to d1upka_ complexed with atp, cit |
PDB Entry: 3gni (more details), 2.35 Å
SCOPe Domain Sequences for d3gnia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gnia_ a.118.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pfpfgkshkspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtneke pqteavaqlaqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyic tqqnilfmllkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdia sdafatfkdlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrh nftimtkyiskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqak lieflskfqndrtedeqfndektylvkqirdlkrp
Timeline for d3gnia_: