Lineage for d3gnia_ (3gni A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725918Family a.118.1.15: Mo25 protein [101407] (2 proteins)
    automatically mapped to Pfam PF08569
    this is a repeat family; one repeat unit is 1upl A:195-240 found in domain
  6. 2725924Protein automated matches [191051] (2 species)
    not a true protein
  7. 2725925Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries)
  8. 2725926Domain d3gnia_: 3gni A: [176776]
    automated match to d1upka_
    complexed with atp, cit

Details for d3gnia_

PDB Entry: 3gni (more details), 2.35 Å

PDB Description: Structure of STRAD and MO25
PDB Compounds: (A:) Protein Mo25

SCOPe Domain Sequences for d3gnia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gnia_ a.118.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfpfgkshkspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtneke
pqteavaqlaqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyic
tqqnilfmllkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdia
sdafatfkdlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrh
nftimtkyiskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqak
lieflskfqndrtedeqfndektylvkqirdlkrp

SCOPe Domain Coordinates for d3gnia_:

Click to download the PDB-style file with coordinates for d3gnia_.
(The format of our PDB-style files is described here.)

Timeline for d3gnia_: