SCOPe 2.08: Domain d3gn8b1: 3gn8 B:-2-245

Lineage for d3gn8b1 (3gn8 B:-2-245)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d3gn8b1: 3gn8 B:-2-245 [176775]
   Other proteins in same PDB: d3gn8a2, d3gn8b2
   automated match to d1m2za_
   complexed with dex

Details for d3gn8b1

PDB Entry: 3gn8, 2.5 Å

PDB Description: X-ray Crystal Structure of AncGR2 in Complex with Dexamethasone

PDB Compounds: (B:) Glucocorticoid receptor 2

SCOPe Domain Sequences for d3gn8b1:

Sequence; same for both SEQRES and ATOM records:

>d3gn8b1 a.123.1.1 (B:-2-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aptlislleviepevlysgydstlpdtstrlmstlnrlggrqvvsavkwakalpgfrnlh
lddqmtllqyswmslmafslgwrsykqsngnmlcfapdlvineermqlpymydqcqqmlk
issefvrlqvsydeylcmkvllllstvpkdglksqavfdeirmtyikelgkaivkregns
sqnwqrfyqltklldsmhemvggllqfcfytfvnkslsvefpemlaeiisnqlpkfkags
vkpllfhq

Timeline for d3gn8b1:

• d3gn8b1 first appeared in SCOPe 2.01, called d3gn8b_
  
• d3gn8b1 was called d3gn8b_ in SCOPe 2.07