Lineage for d3gn4f_ (3gn4 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710683Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)
  8. 2710694Domain d3gn4f_: 3gn4 F: [176772]
    automated match to d2bbma_
    complexed with ca, mg

Details for d3gn4f_

PDB Entry: 3gn4 (more details), 2.7 Å

PDB Description: Myosin lever arm
PDB Compounds: (F:) calmodulin

SCOPe Domain Sequences for d3gn4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gn4f_ a.39.1.5 (F:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeev
demireadidgdgqvnyeefvtmmts

SCOPe Domain Coordinates for d3gn4f_:

Click to download the PDB-style file with coordinates for d3gn4f_.
(The format of our PDB-style files is described here.)

Timeline for d3gn4f_: