Lineage for d3gmya_ (3gmy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967139Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 2967140Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 2967168Family d.98.1.0: automated matches [191579] (1 protein)
    not a true family
  6. 2967169Protein automated matches [191029] (2 species)
    not a true protein
  7. 2967170Species Streptomyces clavuligerus [TaxId:1901] [188840] (2 PDB entries)
  8. 2967173Domain d3gmya_: 3gmy A: [176764]
    automated match to d1s0wc_

Details for d3gmya_

PDB Entry: 3gmy (more details), 1.7 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-like protein (blp), selenomethionine derivative
PDB Compounds: (A:) blp

SCOPe Domain Sequences for d3gmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmya_ d.98.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
reyvcpskaerfapsayftftdgkltsrsqsqlp

SCOPe Domain Coordinates for d3gmya_:

Click to download the PDB-style file with coordinates for d3gmya_.
(The format of our PDB-style files is described here.)

Timeline for d3gmya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gmyb_