| Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
| Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
| Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
| Protein automated matches [190161] (29 species) not a true protein |
| Species Escherichia sp. [TaxId:299586] [188841] (1 PDB entry) |
| Domain d3gmwc_: 3gmw C: [176760] Other proteins in same PDB: d3gmwb_, d3gmwd_ automated match to d1jtda_ complexed with po4 |
PDB Entry: 3gmw (more details), 2.1 Å
SCOPe Domain Sequences for d3gmwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmwc_ e.3.1.1 (C:) automated matches {Escherichia sp. [TaxId: 299586]}
etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
atmdernrqiaeigaslikhw
Timeline for d3gmwc_: