Lineage for d3gmwc_ (3gmw C:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013869Species Escherichia sp. [TaxId:299586] [188841] (1 PDB entry)
  8. 3013871Domain d3gmwc_: 3gmw C: [176760]
    Other proteins in same PDB: d3gmwb_, d3gmwd_
    automated match to d1jtda_
    complexed with po4

Details for d3gmwc_

PDB Entry: 3gmw (more details), 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase
PDB Compounds: (C:) B-lactamase

SCOPe Domain Sequences for d3gmwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmwc_ e.3.1.1 (C:) automated matches {Escherichia sp. [TaxId: 299586]}
etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
atmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3gmwc_:

Click to download the PDB-style file with coordinates for d3gmwc_.
(The format of our PDB-style files is described here.)

Timeline for d3gmwc_: