SCOPe 2.07: Domain d3gmwb_: 3gmw B:

Lineage for d3gmwb_ (3gmw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.0: automated matches [191579] (1 protein)
   not a true family

6. Protein automated matches [191029] (2 species)
   not a true protein

7. Species Streptomyces exfoliatus [TaxId:1905] [188842] (2 PDB entries)

8. Domain d3gmwb_: 3gmw B: [176759]
   Other proteins in same PDB: d3gmwa_, d3gmwc_
   automated match to d1jtgb_
   complexed with po4

Details for d3gmwb_

PDB Entry: 3gmw, 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase

PDB Compounds: (B:) Beta-lactamase inhibitory protein BLIP-I

SCOPe Domain Sequences for d3gmwb_:

Sequence; same for both SEQRES and ATOM records:

>d3gmwb_ d.98.1.0 (B:) automated matches {Streptomyces exfoliatus [TaxId: 1905]}
fsaekyeqiqfgmtfdevweigggeaacdtggvigdsilcftesgdyapyggfsftdege
lwskrneylykaktpsvklshynrtalgmteaqlwaavpkdscvsqgesypnwpaktgfe
ekyycaaatglfppsasfhltdgvltyryqrslt

Timeline for d3gmwb_:

• d3gmwb_ first appeared in SCOPe 2.01
  
• d3gmwb_ appears in SCOPe 2.06
  
• d3gmwb_ appears in the current release, SCOPe 2.08