SCOPe 2.07: Domain d3gmwa_: 3gmw A:

Lineage for d3gmwa_ (3gmw A:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Escherichia sp. [TaxId:299586] [188841] (1 PDB entry)

8. Domain d3gmwa_: 3gmw A: [176758]
   Other proteins in same PDB: d3gmwb_, d3gmwd_
   automated match to d1jtda_
   complexed with po4

Details for d3gmwa_

PDB Entry: 3gmw, 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase

PDB Compounds: (A:) B-lactamase

SCOPe Domain Sequences for d3gmwa_:

Sequence; same for both SEQRES and ATOM records:

>d3gmwa_ e.3.1.1 (A:) automated matches {Escherichia sp. [TaxId: 299586]}
etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
atmdernrqiaeigaslikhw

Timeline for d3gmwa_:

• d3gmwa_ first appeared in SCOPe 2.01
  
• d3gmwa_ appears in SCOPe 2.06
  
• d3gmwa_ appears in the current release, SCOPe 2.08