Lineage for d3gmwa_ (3gmw A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450662Protein automated matches [190161] (19 species)
    not a true protein
  7. 1450787Species Escherichia sp. [TaxId:299586] [188841] (1 PDB entry)
  8. 1450788Domain d3gmwa_: 3gmw A: [176758]
    Other proteins in same PDB: d3gmwb_, d3gmwd_
    automated match to d1jtda_
    complexed with po4

Details for d3gmwa_

PDB Entry: 3gmw (more details), 2.1 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-i (blip-i) in complex with tem-1 beta-lactamase
PDB Compounds: (A:) B-lactamase

SCOPe Domain Sequences for d3gmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmwa_ e.3.1.1 (A:) automated matches {Escherichia sp. [TaxId: 299586]}
etlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvdag
qeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggpke
ltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrqql
idwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttgsq
atmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d3gmwa_:

Click to download the PDB-style file with coordinates for d3gmwa_.
(The format of our PDB-style files is described here.)

Timeline for d3gmwa_: