| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [141879] (7 PDB entries) Uniprot P50172 24-298 |
| Domain d3gmdf_: 3gmd F: [176746] automated match to d1y5ma1 complexed with 2m3, ndp, so4 |
PDB Entry: 3gmd (more details), 2.28 Å
SCOPe Domain Sequences for d3gmdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmdf_ c.2.1.2 (F:) 11-beta-hydroxysteroid dehydrogenase 1 {Mouse (Mus musculus) [TaxId: 10090]}
efrpemlqgkkvivtgaskgigremayhlskmgahvvltarseeglqkvvsrclelgaas
ahyiagtmedmtfaeqfivkagklmggldmlilnhitqtslslfhddihsvrrvmevnfl
syvvmstaalpmlkqsngsiavisslagkvtypmvapysaskfaldgffstirtelyitk
vnvsitlcvlglidtetamkavsgivnaqaspkeecaleiikgtalrksevyydkspltp
illgnpgrkimeffslryynkdmf
Timeline for d3gmdf_: