SCOPe 2.01: Domain d3gm2a_: 3gm2 A:

Lineage for d3gm2a_ (3gm2 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.0: automated matches [191584] (1 protein)
   not a true family

6. Protein automated matches [191041] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188873] (3 PDB entries)

8. Domain d3gm2a_: 3gm2 A: [176739]
   automated match to d1k05b_

Details for d3gm2a_

PDB Entry: 3gm2, 2.71 Å

PDB Description: crystal structure of the focal adhesion targeting (fat) domain of pyk2

PDB Compounds: (A:) Protein tyrosine kinase 2 beta

SCOPe Domain Sequences for d3gm2a_:

Sequence; same for both SEQRES and ATOM records:

>d3gm2a_ a.24.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtddlvylnvmelvravlelknelaqlppegyvvvvknvgltlrkligsvddllpslpss
srteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqmltashtlavdaknlldav
dqakvla

Timeline for d3gm2a_:

• d3gm2a_ is new in SCOPe 2.01-stable
  
• d3gm2a_ appears in SCOPe 2.02
  
• d3gm2a_ appears in the current release, SCOPe 2.08