| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) ![]() |
| Family a.24.14.0: automated matches [191584] (1 protein) not a true family |
| Protein automated matches [191041] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188873] (4 PDB entries) |
| Domain d3gm1b_: 3gm1 B: [176738] automated match to d1k05b_ |
PDB Entry: 3gm1 (more details), 2.95 Å
SCOPe Domain Sequences for d3gm1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gm1b_ a.24.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqptanldrtddlvylnvmelvravlelknelaqlppegyvvvvknvgltlrkligsvdd
llpslpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqmltashtlavd
aknlldavdqakvlanlahpp
Timeline for d3gm1b_: