SCOPe 2.08: Domain d3gm1b_: 3gm1 B:

Lineage for d3gm1b_ (3gm1 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.0: automated matches [191584] (1 protein)
   not a true family

6. Protein automated matches [191041] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188873] (4 PDB entries)

8. Domain d3gm1b_: 3gm1 B: [176738]
   automated match to d1k05b_

Details for d3gm1b_

PDB Entry: 3gm1, 2.95 Å

PDB Description: crystal structure of the focal adhesion targeting (fat) domain of pyk2 in complex with paxillin ld4 motif-derived peptides

PDB Compounds: (B:) Protein tyrosine kinase 2 beta

SCOPe Domain Sequences for d3gm1b_:

Sequence; same for both SEQRES and ATOM records:

>d3gm1b_ a.24.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqptanldrtddlvylnvmelvravlelknelaqlppegyvvvvknvgltlrkligsvdd
llpslpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqmltashtlavd
aknlldavdqakvlanlahpp

Timeline for d3gm1b_:

• d3gm1b_ first appeared in SCOPe 2.01
  
• d3gm1b_ appears in SCOPe 2.07