Lineage for d3gm1a_ (3gm1 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1989048Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 1989084Family a.24.14.0: automated matches [191584] (1 protein)
    not a true family
  6. 1989085Protein automated matches [191041] (1 species)
    not a true protein
  7. 1989086Species Human (Homo sapiens) [TaxId:9606] [188873] (4 PDB entries)
  8. 1989089Domain d3gm1a_: 3gm1 A: [176737]
    automated match to d1k05b_

Details for d3gm1a_

PDB Entry: 3gm1 (more details), 2.95 Å

PDB Description: crystal structure of the focal adhesion targeting (fat) domain of pyk2 in complex with paxillin ld4 motif-derived peptides
PDB Compounds: (A:) Protein tyrosine kinase 2 beta

SCOPe Domain Sequences for d3gm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gm1a_ a.24.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptanldrtddlvylnvmelvravlelknelaqlppegyvvvvknvgltlrkligsvddll
pslpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeckrqmltashtlavdak
nlldavdqakvlanlahppa

SCOPe Domain Coordinates for d3gm1a_:

Click to download the PDB-style file with coordinates for d3gm1a_.
(The format of our PDB-style files is described here.)

Timeline for d3gm1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gm1b_