Lineage for d3glza_ (3glz A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301610Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1301611Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 1301612Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1301633Species Human (Homo sapiens) [TaxId:9606] [49475] (183 PDB entries)
    Uniprot P02766 31-143
  8. 1301884Domain d3glza_: 3glz A: [176735]
    automated match to d1eta1_
    complexed with 1bd

Details for d3glza_

PDB Entry: 3glz (more details), 1.78 Å

PDB Description: Human Transthyretin (TTR) complexed with(E)-3-(2-(trifluoromethyl)benzylideneaminooxy)propanoic acid (inhibitor 11)
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3glza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3glza_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d3glza_:

Click to download the PDB-style file with coordinates for d3glza_.
(The format of our PDB-style files is described here.)

Timeline for d3glza_: