Lineage for d3gl9d_ (3gl9 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856142Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. 2856148Domain d3gl9d_: 3gl9 D: [176733]
    automated match to d1mvoa_
    complexed with mg, so4

Details for d3gl9d_

PDB Entry: 3gl9 (more details), 1.8 Å

PDB Description: The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d3gl9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gl9d_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln

SCOPe Domain Coordinates for d3gl9d_:

Click to download the PDB-style file with coordinates for d3gl9d_.
(The format of our PDB-style files is described here.)

Timeline for d3gl9d_: