SCOPe 2.06: Domain d3gl9a_: 3gl9 A:

Lineage for d3gl9a_ (3gl9 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)

8. Domain d3gl9a_: 3gl9 A: [176730]
   automated match to d1mvoa_
   complexed with mg, so4

Details for d3gl9a_

PDB Entry: 3gl9, 1.8 Å

PDB Description: The structure of a histidine kinase-response regulator complex sheds light into two-component signaling and reveals a novel cis autophosphorylation mechanism

PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d3gl9a_:

Sequence; same for both SEQRES and ATOM records:

>d3gl9a_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln

Timeline for d3gl9a_:

• d3gl9a_ first appeared in SCOPe 2.01
  
• d3gl9a_ appears in SCOPe 2.05
  
• d3gl9a_ appears in SCOPe 2.07
  
• d3gl9a_ appears in the current release, SCOPe 2.08