SCOPe 2.02: Domain d1gsfa1: 1gsf A:81-222

Lineage for d1gsfa1 (1gsf A:81-222)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
   Uniprot P08263

8. Domain d1gsfa1: 1gsf A:81-222 [17673]
   Other proteins in same PDB: d1gsfa2, d1gsfb2, d1gsfc2, d1gsfd2
   complexed with eaa

Details for d1gsfa1

PDB Entry: 1gsf, 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid

PDB Compounds: (A:) glutathione transferase a1-1

SCOPe Domain Sequences for d1gsfa1:

Sequence; same for both SEQRES and ATOM records:

>d1gsfa1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1gsfa1:

• d1gsfa1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsfa1 appears in SCOPe 2.01
  
• d1gsfa1 appears in SCOPe 2.03
  
• d1gsfa1 appears in the current release, SCOPe 2.08