SCOPe 2.06: Domain d3gkxa_: 3gkx A:

Lineage for d3gkxa_ (3gkx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [188839] (3 PDB entries)

8. Domain d3gkxa_: 3gkx A: [176728]
   Other proteins in same PDB: d3gkxb2
   automated match to d1z3ea1

Details for d3gkxa_

PDB Entry: 3gkx, 2.2 Å

PDB Description: Crystal structure of putative ArsC family related protein from Bacteroides fragilis

PDB Compounds: (A:) Putative ArsC family related protein

SCOPe Domain Sequences for d3gkxa_:

Sequence; same for both SEQRES and ATOM records:

>d3gkxa_ c.47.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}
mktlflqypacstcqkakkwliennieytnrlivddnptveelkawiplsglpvkkffnt
sgvvykelklssklptmteeeqiallatngklvkrplvvterfvlvgfkpeeweklk

Timeline for d3gkxa_:

• d3gkxa_ first appeared in SCOPe 2.01
  
• d3gkxa_ appears in SCOPe 2.05
  
• d3gkxa_ appears in SCOPe 2.07
  
• d3gkxa_ appears in the current release, SCOPe 2.08