Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Bacteroides fragilis [TaxId:272559] [188839] (3 PDB entries) |
Domain d3gkxa_: 3gkx A: [176728] Other proteins in same PDB: d3gkxb2 automated match to d1z3ea1 |
PDB Entry: 3gkx (more details), 2.2 Å
SCOPe Domain Sequences for d3gkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gkxa_ c.47.1.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]} mktlflqypacstcqkakkwliennieytnrlivddnptveelkawiplsglpvkkffnt sgvvykelklssklptmteeeqiallatngklvkrplvvterfvlvgfkpeeweklk
Timeline for d3gkxa_: