![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries) |
![]() | Domain d3gkva_: 3gkv A: [176726] Other proteins in same PDB: d3gkvb_ automated match to d1hbha_ complexed with cmo, hem |
PDB Entry: 3gkv (more details), 1.4 Å
SCOPe Domain Sequences for d3gkva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gkva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]} slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d3gkva_: