![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
![]() | Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
![]() | Family d.4.1.1: HNH-motif [54061] (3 proteins) |
![]() | Protein automated matches [190311] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187878] (9 PDB entries) |
![]() | Domain d3gklb_: 3gkl B: [176722] Other proteins in same PDB: d3gklc_, d3gkld_ automated match to d1mz8b_ complexed with zn |
PDB Entry: 3gkl (more details), 2.2 Å
SCOPe Domain Sequences for d3gklb_:
Sequence, based on SEQRES records: (download)
>d3gklb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrh idihrgk
>d3gklb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekvydmdnisvvtpkrhidihrgk
Timeline for d3gklb_: