Lineage for d3gkla_ (3gkl A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174327Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2174328Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2174329Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2174377Protein automated matches [190311] (2 species)
    not a true protein
  7. 2174381Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 2174387Domain d3gkla_: 3gkl A: [176721]
    Other proteins in same PDB: d3gklc_, d3gkld_
    automated match to d1mz8b_
    complexed with zn

Details for d3gkla_

PDB Entry: 3gkl (more details), 2.2 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins
PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d3gkla_:

Sequence, based on SEQRES records: (download)

>d3gkla_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records): (download)

>d3gkla_ d.4.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekvydmdnisvvtpkrhidihrgk

SCOPe Domain Coordinates for d3gkla_:

Click to download the PDB-style file with coordinates for d3gkla_.
(The format of our PDB-style files is described here.)

Timeline for d3gkla_: