Lineage for d3gk4x_ (3gk4 X:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914097Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (14 PDB entries)
  8. 914104Domain d3gk4x_: 3gk4 X: [176717]
    automated match to d1cfpa_
    complexed with 53a, ca

Details for d3gk4x_

PDB Entry: 3gk4 (more details), 1.9 Å

PDB Description: x-ray structure of bovine sbi523,ca(2+)-s100b
PDB Compounds: (X:) Protein S100-B

SCOPe Domain Sequences for d3gk4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gk4x_ a.39.1.2 (X:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffe

SCOPe Domain Coordinates for d3gk4x_:

Click to download the PDB-style file with coordinates for d3gk4x_.
(The format of our PDB-style files is described here.)

Timeline for d3gk4x_: