Lineage for d3gk2a_ (3gk2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710102Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)
  8. 2710125Domain d3gk2a_: 3gk2 A: [176716]
    automated match to d1cfpa_
    complexed with 27a, ca, cac

Details for d3gk2a_

PDB Entry: 3gk2 (more details), 1.98 Å

PDB Description: x-ray structure of bovine sbi279,ca(2+)-s100b
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d3gk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gk2a_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff

SCOPe Domain Coordinates for d3gk2a_:

Click to download the PDB-style file with coordinates for d3gk2a_.
(The format of our PDB-style files is described here.)

Timeline for d3gk2a_: