SCOPe 2.07: Domain d3gjxf_: 3gjx F:

Lineage for d3gjxf_ (3gjx F:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (87 PDB entries)

8. Domain d3gjxf_: 3gjx F: [176714]
   automated match to d1byub_
   protein/RNA complex; complexed with cl, gtp, mg, na

Details for d3gjxf_

PDB Entry: 3gjx, 2.5 Å

PDB Description: crystal structure of the nuclear export complex crm1-snurportin1- rangtp

PDB Compounds: (F:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gjxf_:

Sequence; same for both SEQRES and ATOM records:

>d3gjxf_ c.37.1.8 (F:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam

Timeline for d3gjxf_:

• d3gjxf_ first appeared in SCOPe 2.01
  
• d3gjxf_ appears in SCOPe 2.06
  
• d3gjxf_ appears in the current release, SCOPe 2.08