Lineage for d3gjxc_ (3gjx C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363513Protein Ran [52609] (2 species)
  7. 1363532Species Human (Homo sapiens) [TaxId:9606] [52611] (28 PDB entries)
  8. 1363562Domain d3gjxc_: 3gjx C: [176713]
    automated match to d1byub_
    protein/RNA complex; complexed with cl, gtp, mg, na

Details for d3gjxc_

PDB Entry: 3gjx (more details), 2.5 Å

PDB Description: Crystal Structure of the Nuclear Export Complex CRM1-Snurportin1-RanGTP
PDB Compounds: (C:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gjxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gjxc_ c.37.1.8 (C:) Ran {Human (Homo sapiens) [TaxId: 9606]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam

SCOPe Domain Coordinates for d3gjxc_:

Click to download the PDB-style file with coordinates for d3gjxc_.
(The format of our PDB-style files is described here.)

Timeline for d3gjxc_: