| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) ![]() |
| Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
| Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [140615] (8 PDB entries) Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254 |
| Domain d3gjob_: 3gjo B: [176710] automated match to d1yiga1 |
PDB Entry: 3gjo (more details), 2.5 Å
SCOPe Domain Sequences for d3gjob_:
Sequence, based on SEQRES records: (download)
>d3gjob_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatd
egfvip
>d3gjob_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
deaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegdpvlqrivdilyatdeg
fvip
Timeline for d3gjob_: