| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
| Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
| Protein ImmE9 protein (Im9) [47351] (1 species) |
| Species Escherichia coli [TaxId:562] [47352] (18 PDB entries) |
| Domain d3gjnd_: 3gjn D: [176708] Other proteins in same PDB: d3gjnb_, d3gjnc_ automated match to d1e0ha_ complexed with zn |
PDB Entry: 3gjn (more details), 2.48 Å
SCOPe Domain Sequences for d3gjnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gjnd_ a.28.2.1 (D:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticdaeatseeeldklithfeemtehpsgsdliywpkegddds
psgivntvkqwraangksgfkq
Timeline for d3gjnd_: