Lineage for d3gjnc_ (3gjn C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927849Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 2927897Protein automated matches [190311] (2 species)
    not a true protein
  7. 2927901Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 2927910Domain d3gjnc_: 3gjn C: [176707]
    Other proteins in same PDB: d3gjna_, d3gjnd_
    automated match to d1mz8b_
    complexed with zn

Details for d3gjnc_

PDB Entry: 3gjn (more details), 2.48 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins
PDB Compounds: (C:) Colicin-E7

SCOPe Domain Sequences for d3gjnc_:

Sequence, based on SEQRES records: (download)

>d3gjnc_ d.4.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrh
idihrgk

Sequence, based on observed residues (ATOM records): (download)

>d3gjnc_ d.4.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekvydmdnisvvtpkrhidihrgk

SCOPe Domain Coordinates for d3gjnc_:

Click to download the PDB-style file with coordinates for d3gjnc_.
(The format of our PDB-style files is described here.)

Timeline for d3gjnc_: