| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.1: HNH-motif [54061] (3 proteins) |
| Protein automated matches [190311] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187878] (9 PDB entries) |
| Domain d3gjnc_: 3gjn C: [176707] Other proteins in same PDB: d3gjna_, d3gjnd_ automated match to d1mz8b_ complexed with zn |
PDB Entry: 3gjn (more details), 2.48 Å
SCOPe Domain Sequences for d3gjnc_:
Sequence, based on SEQRES records: (download)
>d3gjnc_ d.4.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrh
idihrgk
>d3gjnc_ d.4.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpel
skqfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekvydmdnisvvtpkrhidihrgk
Timeline for d3gjnc_: