SCOPe 2.03: Domain d3gjnb_: 3gjn B:

Lineage for d3gjnb_ (3gjn B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d3gjnb_: 3gjn B: [176706]
   Other proteins in same PDB: d3gjna_, d3gjnd_
   automated match to d1mz8b_
   complexed with zn

Details for d3gjnb_

PDB Entry: 3gjn, 2.48 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins

PDB Compounds: (B:) Colicin-E7

SCOPe Domain Sequences for d3gjnb_:

Sequence, based on SEQRES records:

>d3gjnb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
katgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpelsk
qfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpisqnggvydmdnisvvtpkrhid
ihrgk

Sequence, based on observed residues (ATOM records):

>d3gjnb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
katgkgkpvnnkwlnnagkdlgspvpdrianklrdkefksfddfrkkfweevskdpelsk
qfsrnnndrmkvgkapktrtqdvsgkrtsfelhaekpvydmdnisvvtpkrhidihrgk

Timeline for d3gjnb_:

• d3gjnb_ first appeared in SCOPe 2.01
  
• d3gjnb_ appears in SCOPe 2.02
  
• d3gjnb_ appears in SCOPe 2.04
  
• d3gjnb_ appears in the current release, SCOPe 2.08