Lineage for d3gjna_ (3gjn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706394Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2706395Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 2706421Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 2706422Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)
  8. 2706439Domain d3gjna_: 3gjn A: [176705]
    Other proteins in same PDB: d3gjnb_, d3gjnc_
    automated match to d1e0ha_
    complexed with zn

Details for d3gjna_

PDB Entry: 3gjn (more details), 2.48 Å

PDB Description: following evolutionary paths to high affinity and selectivity protein- protein interactions using colicin7 and immunity proteins
PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d3gjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gjna_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticdaeatseeeldklithfeemtehpsgsdliywpkegddds
psgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d3gjna_:

Click to download the PDB-style file with coordinates for d3gjna_.
(The format of our PDB-style files is described here.)

Timeline for d3gjna_: