Lineage for d3gjba_ (3gjb A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071025Family b.82.2.9: PhyH-like [141623] (3 protein domains)
    Pfam PF05721
  6. 2071037Protein automated matches [191034] (1 species)
    not a true protein
  7. 2071038Species Streptomyces sp. [TaxId:1931] [188858] (1 PDB entry)
  8. 2071039Domain d3gjba_: 3gjb A: [176698]
    automated match to d2fcta1
    complexed with act, akg, fe2, so4

Details for d3gjba_

PDB Entry: 3gjb (more details), 2.2 Å

PDB Description: cytc3 with fe(ii) and alpha-ketoglutarate
PDB Compounds: (A:) CytC3

SCOPe Domain Sequences for d3gjba_:

Sequence, based on SEQRES records: (download)

>d3gjba_ b.82.2.9 (A:) automated matches {Streptomyces sp. [TaxId: 1931]}
anftfspeevarferdgyigpvkifepeemtrrwniirrqlldrslaiypdsngkanisn
ydrhldidllaehimrpeivdrvgsligrnllcwrseffpkyqgdegtdwhqaatfahat
gkpqiiwpsdegrpafigtitvwtafthsteqngclqlmpgthtsmnydeskgmdydada
inqrekdgikrgffgydyrslqkdpdwkpdesqaypmvlkpgeavifwsntmhaslphtg
sktdyrmgfaaryvptqvqvypgtenlteygdginlekygavltsgvdeyghnriartsq
rgyefvprqi

Sequence, based on observed residues (ATOM records): (download)

>d3gjba_ b.82.2.9 (A:) automated matches {Streptomyces sp. [TaxId: 1931]}
anftfspeevarferdgyigpvkifepeemtrrwniirrqlldrslaiypdsngkanisn
ydrhldidllaehimrpeivdrvgsligrnllcwrseffpkyqgdegtdwhqaatfahat
gkpqiiwpsdrpafigtitvwtafthsteqngclqlmpgtnydaypmvlkpgeavifwsn
tmhaslphtgsktdyrmgfaaryvptqvqvypgtenlteygdginlekygavltsgvdey
ghnriartsqrgyefvprqi

SCOPe Domain Coordinates for d3gjba_:

Click to download the PDB-style file with coordinates for d3gjba_.
(The format of our PDB-style files is described here.)

Timeline for d3gjba_: