Lineage for d3gj8c_ (3gj8 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846662Protein Ran [52609] (2 species)
  7. 1846687Species Human (Homo sapiens) [TaxId:9606] [52611] (40 PDB entries)
  8. 1846692Domain d3gj8c_: 3gj8 C: [176697]
    Other proteins in same PDB: d3gj8b_, d3gj8d_
    automated match to d1byub_
    protein/DNA complex; protein/RNA complex; complexed with gdp, mg, zn

Details for d3gj8c_

PDB Entry: 3gj8 (more details), 1.82 Å

PDB Description: crystal structure of human rangdp-nup153znf34 complex
PDB Compounds: (C:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gj8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gj8c_ c.37.1.8 (C:) Ran {Human (Homo sapiens) [TaxId: 9606]}
epqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqttal

SCOPe Domain Coordinates for d3gj8c_:

Click to download the PDB-style file with coordinates for d3gj8c_.
(The format of our PDB-style files is described here.)

Timeline for d3gj8c_: