SCOPe 2.06: Domain d3gj8a_: 3gj8 A:

Lineage for d3gj8a_ (3gj8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (43 PDB entries)

8. Domain d3gj8a_: 3gj8 A: [176696]
   Other proteins in same PDB: d3gj8b_, d3gj8d_
   automated match to d1byub_
   protein/DNA complex; protein/RNA complex; complexed with gdp, mg, zn

Details for d3gj8a_

PDB Entry: 3gj8, 1.82 Å

PDB Description: Crystal structure of human RanGDP-Nup153ZnF34 complex

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gj8a_:

Sequence; same for both SEQRES and ATOM records:

>d3gj8a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
epqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqttal

Timeline for d3gj8a_:

• d3gj8a_ first appeared in SCOPe 2.01
  
• d3gj8a_ appears in SCOPe 2.05
  
• d3gj8a_ appears in the current release, SCOPe 2.07