Class a: All alpha proteins [46456] (171 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins) |
Protein Class alpha GST [81349] (6 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (10 PDB entries) |
Domain d1gsda1: 1gsd A:81-209 [17669] Other proteins in same PDB: d1gsda2, d1gsdb2 |
PDB Entry: 1gsd (more details), 2.5 Å
SCOP Domain Sequences for d1gsda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsda1 a.45.1.1 (A:81-209) Class alpha GST {Human (Homo sapiens), (a1-1)} lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmd
Timeline for d1gsda1: