SCOPe 2.03: Domain d3gj5a_: 3gj5 A:

Lineage for d3gj5a_ (3gj5 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (28 PDB entries)

8. Domain d3gj5a_: 3gj5 A: [176689]
   Other proteins in same PDB: d3gj5b_, d3gj5d_
   automated match to d1byub_
   protein/DNA complex; protein/RNA complex; complexed with gdp, mg, zn

Details for d3gj5a_

PDB Entry: 3gj5, 1.79 Å

PDB Description: crystal structure of human rangdp-nup153znf4 complex

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gj5a_:

Sequence; same for both SEQRES and ATOM records:

>d3gj5a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtta

Timeline for d3gj5a_:

• d3gj5a_ first appeared in SCOPe 2.01
  
• d3gj5a_ appears in SCOPe 2.02
  
• d3gj5a_ appears in SCOPe 2.04
  
• d3gj5a_ appears in the current release, SCOPe 2.08