| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Ran [52609] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries) |
| Domain d3gj4a_: 3gj4 A: [176687] automated match to d1byub_ protein/DNA complex; protein/RNA complex; complexed with gdp, mg, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3gj4 (more details), 2.15 Å
SCOPe Domain Sequences for d3gj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gj4a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtta
Timeline for d3gj4a_: