Lineage for d3gj2d_ (3gj2 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1898889Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 1898895Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (167 PDB entries)
    Uniprot P42212
  8. 1899020Domain d3gj2d_: 3gj2 D: [176684]
    automated match to d1q4aa_
    complexed with cl

Details for d3gj2d_

PDB Entry: 3gj2 (more details), 1.9 Å

PDB Description: photoactivated state of pa-gfp
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d3gj2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gj2d_ d.22.1.1 (D:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylshqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d3gj2d_:

Click to download the PDB-style file with coordinates for d3gj2d_.
(The format of our PDB-style files is described here.)

Timeline for d3gj2d_: